![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
![]() | Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) ![]() |
![]() | Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins) automatically mapped to Pfam PF01156 |
![]() | Protein automated matches [190287] (4 species) not a true protein |
![]() | Species Trypanosoma vivax [TaxId:5699] [187091] (5 PDB entries) |
![]() | Domain d2ff2b2: 2ff2 B:2-327 [133363] Other proteins in same PDB: d2ff2b3 automated match to d1hoza_ complexed with ca, imh, ni |
PDB Entry: 2ff2 (more details), 2.2 Å
SCOPe Domain Sequences for d2ff2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ff2b2 c.70.1.1 (B:2-327) automated matches {Trypanosoma vivax [TaxId: 5699]} aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm wamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaen ypltfvarnpeaeffldmllrsarac
Timeline for d2ff2b2: