SCOP 1.73: Domain d2ff2a1: 2ff2 A:2-327

Lineage for d2ff2a1 (2ff2 A:2-327)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
   core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest

4. Superfamily c.70.1: Nucleoside hydrolase [53590] (1 family)

5. Family c.70.1.1: Nucleoside hydrolase [53591] (4 proteins)

6. Protein Inosine-adenosine-guanosine preferring nucleoside hydrolase [69587] (1 species)

7. Species Trypanosoma vivax [TaxId:5699] [69588] (7 PDB entries)

8. Domain d2ff2a1: 2ff2 A:2-327 [133362]
   automatically matched to d1hoza_
   complexed with ca, imh, ni

Details for d2ff2a1

PDB Entry: 2ff2, 2.2 Å

PDB Description: crystal structure of trypanosoma vivax nucleoside hydrolase co- crystallized with immucillinh

PDB Compounds: (A:) IAG-nucleoside hydrolase

SCOP Domain Sequences for d2ff2a1:

Sequence; same for both SEQRES and ATOM records:

>d2ff2a1 c.70.1.1 (A:2-327) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaen
ypltfvarnpeaeffldmllrsarac

Timeline for d2ff2a1:

• d2ff2a1 is new in SCOP 1.73
  
• d2ff2a1 appears in SCOP 1.75
  
• d2ff2a1 appears in the current release, SCOPe 2.08, called d2ff2a_