![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
![]() | Superfamily c.70.1: Nucleoside hydrolase [53590] (1 family) ![]() |
![]() | Family c.70.1.1: Nucleoside hydrolase [53591] (4 proteins) |
![]() | Protein Inosine-adenosine-guanosine preferring nucleoside hydrolase [69587] (1 species) |
![]() | Species Trypanosoma vivax [TaxId:5699] [69588] (7 PDB entries) |
![]() | Domain d2ff2a1: 2ff2 A:2-327 [133362] automatically matched to d1hoza_ complexed with ca, imh, ni |
PDB Entry: 2ff2 (more details), 2.2 Å
SCOP Domain Sequences for d2ff2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ff2a1 c.70.1.1 (A:2-327) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]} aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm wamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaen ypltfvarnpeaeffldmllrsarac
Timeline for d2ff2a1: