SCOPe 2.08: Domain d2ff2a_: 2ff2 A:

Lineage for d2ff2a_ (2ff2 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
   core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest

4. Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families)

5. Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
   automatically mapped to Pfam PF01156

6. Protein automated matches [190287] (4 species)
   not a true protein

7. Species Trypanosoma vivax [TaxId:5699] [187091] (5 PDB entries)

8. Domain d2ff2a_: 2ff2 A: [133362]
   Other proteins in same PDB: d2ff2b3
   automated match to d1hoza_
   complexed with ca, imh, ni

Details for d2ff2a_

PDB Entry: 2ff2, 2.2 Å

PDB Description: crystal structure of trypanosoma vivax nucleoside hydrolase co- crystallized with immucillinh

PDB Compounds: (A:) IAG-nucleoside hydrolase

SCOPe Domain Sequences for d2ff2a_:

Sequence; same for both SEQRES and ATOM records:

>d2ff2a_ c.70.1.1 (A:) automated matches {Trypanosoma vivax [TaxId: 5699]}
aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaen
ypltfvarnpeaeffldmllrsarac

Timeline for d2ff2a_:

• d2ff2a_ first appeared in SCOP 1.73, called d2ff2a1
  
• d2ff2a_ appears in SCOPe 2.07