Lineage for d2feza2 (2fez A:105-283)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775881Family a.118.8.3: BTAD-like [140845] (1 protein)
    Pfam PF03704; Bacterial transcriptional activator domain
  6. 775882Protein Probable regulatory protein EmbR, middle domain [140846] (1 species)
  7. 775883Species Mycobacterium tuberculosis [TaxId:1773] [140847] (2 PDB entries)
    Uniprot P66799 105-283
  8. 775886Domain d2feza2: 2fez A:105-283 [133358]
    Other proteins in same PDB: d2feza1, d2feza3

Details for d2feza2

PDB Entry: 2fez (more details), 2 Å

PDB Description: Mycobacterium tuberculosis EmbR
PDB Compounds: (A:) Probable regulatory protein embR

SCOP Domain Sequences for d2feza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feza2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}
ipdntcdlgrfvaektagvhaaaagrfeqasrhlsaalrewrgpvlddlrdfqfvepfat
alvedkvlahtakaeaeiacgrasaviaelealtfehpyreplwtqlitayylsdrqsda
lgayrrvkttladdlgidpgptlralnerilrqqpldakksakttaagtvtvldqrtma

SCOP Domain Coordinates for d2feza2:

Click to download the PDB-style file with coordinates for d2feza2.
(The format of our PDB-style files is described here.)

Timeline for d2feza2: