Lineage for d2feza1 (2fez A:10-104)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 635945Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 635946Family a.4.6.1: PhoB-like [46895] (5 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 635962Protein Probable regulatory protein EmbR [140313] (1 species)
    N-terminal domain, unlike the other members
  7. 635963Species Mycobacterium tuberculosis [TaxId:1773] [140314] (2 PDB entries)
  8. 635966Domain d2feza1: 2fez A:10-104 [133357]
    Other proteins in same PDB: d2feza2, d2feza3

Details for d2feza1

PDB Entry: 2fez (more details), 2 Å

PDB Description: Mycobacterium tuberculosis EmbR
PDB Compounds: (A:) Probable regulatory protein embR

SCOP Domain Sequences for d2feza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feza1 a.4.6.1 (A:10-104) Probable regulatory protein EmbR {Mycobacterium tuberculosis [TaxId: 1773]}
rldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalweewppsgar
asihsyvsnlrkllggagidprvvlaaappgyrls

SCOP Domain Coordinates for d2feza1:

Click to download the PDB-style file with coordinates for d2feza1.
(The format of our PDB-style files is described here.)

Timeline for d2feza1: