SCOPe 2.07: Domain d2fexc_: 2fex C:

Lineage for d2fexc_ (2fex C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein Hypothetical protein Atu0886 [142072] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [142073] (1 PDB entry)
   Uniprot Q8UGZ9 1-188

8. Domain d2fexc_: 2fex C: [133356]
   automated match to d2fexa1
   complexed with gol, so4

Details for d2fexc_

PDB Entry: 2fex, 1.7 Å

PDB Description: the crystal structure of dj-1 superfamily protein atu0886 from agrobacterium tumefaciens

PDB Compounds: (C:) conserved hypothetical protein

SCOPe Domain Sequences for d2fexc_:

Sequence; same for both SEQRES and ATOM records:

>d2fexc_ c.23.16.2 (C:) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]}
mtriaialaqdfadwepallaaaarsylgveivhatpdgmpvtsmgglkvtpdtsydald
pvdidalvipgglswekgtaadlgglvkrfrdrdrlvagicaaasalggtgvlndvahtg
nalashkaypayrgeahyrdqpravsdggvvtaagsapvsfaveilkslglfgpeaeael
qifaaehr

Timeline for d2fexc_:

• d2fexc_ first appeared in SCOP 1.73, called d2fexc1
  
• d2fexc_ appears in SCOPe 2.06
  
• d2fexc_ appears in the current release, SCOPe 2.08