Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
Protein Hypothetical protein Atu0886 [142072] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [142073] (1 PDB entry) Uniprot Q8UGZ9 1-188 |
Domain d2fexc_: 2fex C: [133356] automated match to d2fexa1 complexed with gol, so4 |
PDB Entry: 2fex (more details), 1.7 Å
SCOPe Domain Sequences for d2fexc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fexc_ c.23.16.2 (C:) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} mtriaialaqdfadwepallaaaarsylgveivhatpdgmpvtsmgglkvtpdtsydald pvdidalvipgglswekgtaadlgglvkrfrdrdrlvagicaaasalggtgvlndvahtg nalashkaypayrgeahyrdqpravsdggvvtaagsapvsfaveilkslglfgpeaeael qifaaehr
Timeline for d2fexc_: