Lineage for d2fexc_ (2fex C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858933Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2859036Protein Hypothetical protein Atu0886 [142072] (1 species)
  7. 2859037Species Agrobacterium tumefaciens [TaxId:358] [142073] (1 PDB entry)
    Uniprot Q8UGZ9 1-188
  8. 2859040Domain d2fexc_: 2fex C: [133356]
    automated match to d2fexa1
    complexed with gol, so4

Details for d2fexc_

PDB Entry: 2fex (more details), 1.7 Å

PDB Description: the crystal structure of dj-1 superfamily protein atu0886 from agrobacterium tumefaciens
PDB Compounds: (C:) conserved hypothetical protein

SCOPe Domain Sequences for d2fexc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fexc_ c.23.16.2 (C:) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]}
mtriaialaqdfadwepallaaaarsylgveivhatpdgmpvtsmgglkvtpdtsydald
pvdidalvipgglswekgtaadlgglvkrfrdrdrlvagicaaasalggtgvlndvahtg
nalashkaypayrgeahyrdqpravsdggvvtaagsapvsfaveilkslglfgpeaeael
qifaaehr

SCOPe Domain Coordinates for d2fexc_:

Click to download the PDB-style file with coordinates for d2fexc_.
(The format of our PDB-style files is described here.)

Timeline for d2fexc_: