![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
![]() | Protein Hypothetical protein Atu0886 [142072] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [142073] (1 PDB entry) |
![]() | Domain d2fexa1: 2fex A:1-188 [133354] complexed with gol, so4 |
PDB Entry: 2fex (more details), 1.7 Å
SCOP Domain Sequences for d2fexa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} mtriaialaqdfadwepallaaaarsylgveivhatpdgmpvtsmgglkvtpdtsydald pvdidalvipgglswekgtaadlgglvkrfrdrdrlvagicaaasalggtgvlndvahtg nalashkaypayrgeahyrdqpravsdggvvtaagsapvsfaveilkslglfgpeaeael qifaaehr
Timeline for d2fexa1: