Class a: All alpha proteins [46456] (258 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (1 family) |
Family a.104.1.1: Cytochrome P450 [48265] (21 proteins) |
Protein Cytochrome P450-CAM [48266] (1 species) |
Species Pseudomonas putida [TaxId:303] [48267] (57 PDB entries) |
Domain d2feua1: 2feu A:11-414 [133352] automatically matched to d1p2ya_ complexed with cam, k, mnr, trs |
PDB Entry: 2feu (more details), 1.7 Å
SCOP Domain Sequences for d2feua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2feua1 a.104.1.1 (A:11-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl dtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgv qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d2feua1: