Lineage for d2feja_ (2fej A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2040932Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2040933Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2040934Species Human (Homo sapiens) [TaxId:9606] [49420] (40 PDB entries)
  8. 2041033Domain d2feja_: 2fej A: [133349]
    automated match to d3igla_
    complexed with zn

Details for d2feja_

PDB Entry: 2fej (more details)

PDB Description: solution structure of human p53 dna binding domain.
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2feja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feja_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
vcacpgrdrrteeenlrkkgephh

SCOPe Domain Coordinates for d2feja_:

Click to download the PDB-style file with coordinates for d2feja_.
(The format of our PDB-style files is described here.)

Timeline for d2feja_: