Lineage for d2fefc2 (2fef C:135-293)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754601Fold a.254: PA2201 C-terminal domain-like [140730] (1 superfamily)
    multihelical; seven-helical bundle with buried central helix
  4. 1754602Superfamily a.254.1: PA2201 C-terminal domain-like [140731] (1 family) (S)
  5. 1754603Family a.254.1.1: PA2201 C-terminal domain-like [140732] (1 protein)
  6. 1754604Protein Hypothetical protein PA2201 [140733] (1 species)
  7. 1754605Species Pseudomonas aeruginosa [TaxId:287] [140734] (1 PDB entry)
    Uniprot Q9I1R6 135-293
  8. 1754608Domain d2fefc2: 2fef C:135-293 [133348]
    Other proteins in same PDB: d2fefa1, d2fefb1, d2fefc1
    automated match to d2fefa2
    complexed with edo

Details for d2fefc2

PDB Entry: 2fef (more details), 1.9 Å

PDB Description: the crystal structure of protein pa2201 from pseudomonas aeruginosa
PDB Compounds: (C:) hypothetical protein PA2201

SCOPe Domain Sequences for d2fefc2:

Sequence, based on SEQRES records: (download)

>d2fefc2 a.254.1.1 (C:135-293) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
tapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalgltsa
seetfhprpfgqlraffeeadgsdaqalapylqsqyreffqlspkaqkktrrltgpyawg
wwamevsalgvlygwddgvlrasphylgdlvdyarargd

Sequence, based on observed residues (ATOM records): (download)

>d2fefc2 a.254.1.1 (C:135-293) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
tapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalgltsa
seetfhprpfgqlraffeegsdaqalapylqsqyreffqlspkaqkktrrltgpyawgww
amevsalgvlygwddgvlrasphylgdlvdyarargd

SCOPe Domain Coordinates for d2fefc2:

Click to download the PDB-style file with coordinates for d2fefc2.
(The format of our PDB-style files is described here.)

Timeline for d2fefc2: