SCOPe 2.06: Domain d2fefb1: 2fef B:6-129

Lineage for d2fefb1 (2fef B:6-129)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.11: PA2201 N-terminal domain-like [140486] (1 family)

5. Family a.29.11.1: PA2201 N-terminal domain-like [140487] (1 protein)
   trimerisation domain

6. Protein Hypothetical protein PA2201 [140488] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140489] (1 PDB entry)
   Uniprot Q9I1R6 6-129

8. Domain d2fefb1: 2fef B:6-129 [133345]
   Other proteins in same PDB: d2fefa2, d2fefb2, d2fefc2
   automated match to d2fefa1
   complexed with edo

Details for d2fefb1

PDB Entry: 2fef, 1.9 Å

PDB Description: The Crystal Structure of Protein PA2201 from Pseudomonas aeruginosa

PDB Compounds: (B:) hypothetical protein PA2201

SCOPe Domain Sequences for d2fefb1:

Sequence; same for both SEQRES and ATOM records:

>d2fefb1 a.29.11.1 (B:6-129) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
ltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrqpfaaq
ghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllgaardsl
reqg

Timeline for d2fefb1:

• d2fefb1 first appeared in SCOP 1.73
  
• d2fefb1 appears in SCOPe 2.05
  
• d2fefb1 appears in the current release, SCOPe 2.07