Lineage for d2fefa1 (2fef A:6-129)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639849Fold a.29: Bromodomain-like [47363] (10 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 640038Superfamily a.29.11: PA2201 N-terminal domain-like [140486] (1 family) (S)
  5. 640039Family a.29.11.1: PA2201 N-terminal domain-like [140487] (1 protein)
    trimerisation domain
  6. 640040Protein Hypothetical protein PA2201 [140488] (1 species)
  7. 640041Species Pseudomonas aeruginosa [TaxId:287] [140489] (1 PDB entry)
  8. 640042Domain d2fefa1: 2fef A:6-129 [133343]
    Other proteins in same PDB: d2fefa2, d2fefb2, d2fefc2
    complexed with edo

Details for d2fefa1

PDB Entry: 2fef (more details), 1.9 Å

PDB Description: the crystal structure of protein pa2201 from pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein PA2201

SCOP Domain Sequences for d2fefa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fefa1 a.29.11.1 (A:6-129) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
ltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrqpfaaq
ghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllgaardsl
reqg

SCOP Domain Coordinates for d2fefa1:

Click to download the PDB-style file with coordinates for d2fefa1.
(The format of our PDB-style files is described here.)

Timeline for d2fefa1: