Lineage for d2feel1 (2fee L:1-105)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741215Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 2741259Domain d2feel1: 2fee L:1-105 [133339]
    Other proteins in same PDB: d2feea1, d2feeb1, d2feel2, d2feeo2
    automatically matched to d1dqdl1

Details for d2feel1

PDB Entry: 2fee (more details), 3.2 Å

PDB Description: Structure of the Cl-/H+ exchanger CLC-ec1 from E.Coli in NaBr
PDB Compounds: (L:) Fab fragment, light chain

SCOPe Domain Sequences for d2feel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feel1 b.1.1.1 (L:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtklei

SCOPe Domain Coordinates for d2feel1:

Click to download the PDB-style file with coordinates for d2feel1.
(The format of our PDB-style files is described here.)

Timeline for d2feel1: