Lineage for d2fedd2 (2fed D:107-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2748803Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2748984Domain d2fedd2: 2fed D:107-210 [133334]
    Other proteins in same PDB: d2feda1, d2fedb1, d2fedd1, d2fedf1
    automatically matched to d1dqdl2
    mutant

Details for d2fedd2

PDB Entry: 2fed (more details), 3.32 Å

PDB Description: structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli
PDB Compounds: (D:) Fab fragment, light chain

SCOPe Domain Sequences for d2fedd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fedd2 b.1.1.2 (D:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d2fedd2:

Click to download the PDB-style file with coordinates for d2fedd2.
(The format of our PDB-style files is described here.)

Timeline for d2fedd2: