Lineage for d2feco2 (2fec O:107-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656513Domain d2feco2: 2fec O:107-210 [133332]
    Other proteins in same PDB: d2fecl1, d2feco1
    automatically matched to d1dqdl2
    mutant

Details for d2feco2

PDB Entry: 2fec (more details), 3.97 Å

PDB Description: Structure of the E203Q mutant of the Cl-/H+ exchanger CLC-ec1 from E.Coli
PDB Compounds: (O:) Fab fragment, light chain

SCOP Domain Sequences for d2feco2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feco2 b.1.1.2 (O:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d2feco2:

Click to download the PDB-style file with coordinates for d2feco2.
(The format of our PDB-style files is described here.)

Timeline for d2feco2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2feco1