SCOP 1.73: Domain d2feco2: 2fec O:107-210

Lineage for d2feco2 (2fec O:107-210)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d2feco2: 2fec O:107-210 [133332]
   Other proteins in same PDB: d2fecl1, d2feco1
   automatically matched to d1dqdl2
   mutant

Details for d2feco2

PDB Entry: 2fec, 3.97 Å

PDB Description: structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli

PDB Compounds: (O:) Fab fragment, light chain

SCOP Domain Sequences for d2feco2:

Sequence; same for both SEQRES and ATOM records:

>d2feco2 b.1.1.2 (O:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d2feco2:

• d2feco2 is new in SCOP 1.73
  
• d2feco2 appears in SCOP 1.75
  
• d2feco2 appears in the current release, SCOPe 2.08