Lineage for d2feco2 (2fec O:107-210)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. Domain d2feco2: 2fec O:107-210 [133332]
    Other proteins in same PDB: d2feca1, d2fecb1, d2fecl1, d2feco1
    automatically matched to d1dqdl2
    mutant

Details for d2feco2

PDB Entry: 2fec (more details), 3.97 Å

PDB Description: Structure of the E203Q mutant of the Cl-/H+ exchanger CLC-ec1 from E.Coli
PDB Compounds: (O:) Fab fragment, light chain

SCOPe Domain Sequences for d2feco2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feco2 b.1.1.2 (O:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d2feco2 are not available.

Timeline for d2feco2:

Domains from same chain:
(mouse over for more information)
d2feco1
Domains from other chains:
(mouse over for more information)
d2feca1, d2fecb1, d2fecl1, d2fecl2