Lineage for d2feab_ (2fea B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527459Family c.108.1.20: MtnX-like [142180] (1 protein)
    Pfam PF06888; the insertion subdomain is a rudiment 4-helical bundle
  6. 2527460Protein 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX [142181] (1 species)
  7. 2527461Species Bacillus subtilis [TaxId:1423] [142182] (1 PDB entry)
    Uniprot O31667 2-227
  8. 2527463Domain d2feab_: 2fea B: [133328]
    automated match to d2feaa1
    complexed with edo, mg, zn

Details for d2feab_

PDB Entry: 2fea (more details), 2 Å

PDB Description: Crystal structure of MtnX phosphatase from Bacillus Subtilis at 2.00 A resolution
PDB Compounds: (B:) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase

SCOPe Domain Sequences for d2feab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feab_ c.108.1.20 (B:) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]}
trkpfiicdfdgtitmndniinimktfappewmalkdgvlsktlsikegvgrmfgllpss
lkeeitsfvledakiregfrefvafineheipfyvisggmdffvypllegivekdriycn
hasfdndyihidwphsckgtcsnqcgcckpsvihelsepnqyiimigdsvtdveaaklsd
lcfardyllnecreqnlnhlpyqdfyeirkeienvkevqewlqn

SCOPe Domain Coordinates for d2feab_:

Click to download the PDB-style file with coordinates for d2feab_.
(The format of our PDB-style files is described here.)

Timeline for d2feab_: