SCOP 1.73: Domain d2feab1: 2fea B:3-226

Lineage for d2feab1 (2fea B:3-226)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.20: MtnX-like [142180] (1 protein)
   Pfam PF06888; the insertion subdomain is a rudiment 4-helical bundle

6. Protein 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX [142181] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [142182] (1 PDB entry)

8. Domain d2feab1: 2fea B:3-226 [133328]
   automatically matched to 2FEA A:2-227
   complexed with edo, mg, zn

Details for d2feab1

PDB Entry: 2fea, 2 Å

PDB Description: Crystal structure of MtnX phosphatase from Bacillus Subtilis at 2.00 A resolution

PDB Compounds: (B:) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase

SCOP Domain Sequences for d2feab1:

Sequence; same for both SEQRES and ATOM records:

>d2feab1 c.108.1.20 (B:3-226) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]}
trkpfiicdfdgtitmndniinimktfappewmalkdgvlsktlsikegvgrmfgllpss
lkeeitsfvledakiregfrefvafineheipfyvisggmdffvypllegivekdriycn
hasfdndyihidwphsckgtcsnqcgcckpsvihelsepnqyiimigdsvtdveaaklsd
lcfardyllnecreqnlnhlpyqdfyeirkeienvkevqewlqn

Timeline for d2feab1:

• d2feab1 is new in SCOP 1.73
  
• d2feab1 appears in SCOP 1.75
  
• d2feab1 appears in the current release, SCOPe 2.08, called d2feab_