Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.20: MtnX-like [142180] (1 protein) Pfam PF06888; the insertion subdomain is a rudiment 4-helical bundle |
Protein 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX [142181] (1 species) |
Species Bacillus subtilis [TaxId:1423] [142182] (1 PDB entry) Uniprot O31667 2-227 |
Domain d2feaa1: 2fea A:2-227 [133327] complexed with edo, mg, zn |
PDB Entry: 2fea (more details), 2 Å
SCOPe Domain Sequences for d2feaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} ttrkpfiicdfdgtitmndniinimktfappewmalkdgvlsktlsikegvgrmfgllps slkeeitsfvledakiregfrefvafineheipfyvisggmdffvypllegivekdriyc nhasfdndyihidwphsckgtcsnqcgcckpsvihelsepnqyiimigdsvtdveaakls dlcfardyllnecreqnlnhlpyqdfyeirkeienvkevqewlqnk
Timeline for d2feaa1: