SCOPe 2.08: Domain d2feaa1: 2fea A:2-227

Lineage for d2feaa1 (2fea A:2-227)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.20: MtnX-like [142180] (1 protein)
   Pfam PF06888; the insertion subdomain is a rudiment 4-helical bundle

6. Protein 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX [142181] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [142182] (1 PDB entry)
   Uniprot O31667 2-227

8. Domain d2feaa1: 2fea A:2-227 [133327]
   complexed with edo, mg, zn

Details for d2feaa1

PDB Entry: 2fea, 2 Å

PDB Description: Crystal structure of MtnX phosphatase from Bacillus Subtilis at 2.00 A resolution

PDB Compounds: (A:) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase

SCOPe Domain Sequences for d2feaa1:

Sequence; same for both SEQRES and ATOM records:

>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]}
ttrkpfiicdfdgtitmndniinimktfappewmalkdgvlsktlsikegvgrmfgllps
slkeeitsfvledakiregfrefvafineheipfyvisggmdffvypllegivekdriyc
nhasfdndyihidwphsckgtcsnqcgcckpsvihelsepnqyiimigdsvtdveaakls
dlcfardyllnecreqnlnhlpyqdfyeirkeienvkevqewlqnk

Timeline for d2feaa1:

• d2feaa1 first appeared in SCOP 1.73
  
• d2feaa1 appears in SCOPe 2.07