Lineage for d2fe7b_ (2fe7 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) 
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) 
Protein automated matches [190241] (10 species)
not a true protein
Species Pseudomonas aeruginosa [TaxId:208963] [187700] (1 PDB entry) 
Domain d2fe7b_: 2fe7 B: [133326]
Other proteins in same PDB: d2fe7a1
automated match to d2fe7a1
Details for d2fe7b_
PDB Entry: 2fe7 (more details), 2 Å
PDB Description: the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa
PDB Compounds: (B:) probable N-acetyltransferaseSCOPe Domain Sequences for d2fe7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe7b_ d.108.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
enlyfqghmtleirpavpadaeqilafiieladyerarhevvtdvegirrslfaegsptr
almclsegrpigyavffysystwlgrngiyledlyvtpeyrgvgagrrllrelareavan
dcgrlewsvldwnqpaidfyrsigalpqdewvryrldgealrkmae
SCOPe Domain Coordinates for d2fe7b_:
Click to download the PDB-style file with coordinates for d2fe7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fe7b_:
- d2fe7b_ first appeared in SCOP 1.73, called d2fe7b1
- d2fe7b_ appears in SCOPe 2.04
- d2fe7b_ is called d2fe7b2 in SCOPe 2.06
- d2fe7b_ appears in the current release, SCOPe 2.08, called d2fe7b2
View in 3D
