![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins) |
![]() | Protein Probable N-acetyltransferase PA0478 [143676] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143677] (1 PDB entry) Uniprot Q9I640 3-158 |
![]() | Domain d2fe7b1: 2fe7 B:3-158 [133326] automatically matched to 2FE7 A:3-158 mutant |
PDB Entry: 2fe7 (more details), 2 Å
SCOP Domain Sequences for d2fe7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe7b1 d.108.1.1 (B:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} leirpavpadaeqilafiieladyerarhevvtdvegirrslfaegsptralmclsegrp igyavffysystwlgrngiyledlyvtpeyrgvgagrrllrelareavandcgrlewsvl dwnqpaidfyrsigalpqdewvryrldgealrkmae
Timeline for d2fe7b1: