Lineage for d2fe7b1 (2fe7 B:3-158)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870001Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870002Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) (S)
  5. 870003Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins)
  6. 870277Protein Probable N-acetyltransferase PA0478 [143676] (1 species)
  7. 870278Species Pseudomonas aeruginosa [TaxId:287] [143677] (1 PDB entry)
    Uniprot Q9I640 3-158
  8. 870280Domain d2fe7b1: 2fe7 B:3-158 [133326]
    automatically matched to 2FE7 A:3-158
    mutant

Details for d2fe7b1

PDB Entry: 2fe7 (more details), 2 Å

PDB Description: the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa
PDB Compounds: (B:) probable N-acetyltransferase

SCOP Domain Sequences for d2fe7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fe7b1 d.108.1.1 (B:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]}
leirpavpadaeqilafiieladyerarhevvtdvegirrslfaegsptralmclsegrp
igyavffysystwlgrngiyledlyvtpeyrgvgagrrllrelareavandcgrlewsvl
dwnqpaidfyrsigalpqdewvryrldgealrkmae

SCOP Domain Coordinates for d2fe7b1:

Click to download the PDB-style file with coordinates for d2fe7b1.
(The format of our PDB-style files is described here.)

Timeline for d2fe7b1: