Class b: All beta proteins [48724] (177 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Synapse-associated protein 102 [101713] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101714] (2 PDB entries) |
Domain d2fe5a1: 2fe5 A:223-314 [133323] Other proteins in same PDB: d2fe5a2 2nd PDZ domain complexed with gol, so4 |
PDB Entry: 2fe5 (more details), 1.1 Å
SCOPe Domain Sequences for d2fe5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} timevnllkgpkglgfsiaggignqhipgdnsiyitkiieggaaqkdgrlqigdrllavn ntnlqdvrheeavaslkntsdmvylkvakpgs
Timeline for d2fe5a1: