SCOPe 2.06: Domain d2fe5a1: 2fe5 A:223-314

Lineage for d2fe5a1 (2fe5 A:223-314)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Synapse-associated protein 102 [101713] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101714] (2 PDB entries)

8. Domain d2fe5a1: 2fe5 A:223-314 [133323]
   Other proteins in same PDB: d2fe5a2
   2nd PDZ domain
   complexed with gol, so4

Details for d2fe5a1

PDB Entry: 2fe5, 1.1 Å

PDB Description: The Crystal Structure of the Second PDZ Domain of Human DLG3

PDB Compounds: (A:) Presynaptic protein SAP102

SCOPe Domain Sequences for d2fe5a1:

Sequence; same for both SEQRES and ATOM records:

>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]}
timevnllkgpkglgfsiaggignqhipgdnsiyitkiieggaaqkdgrlqigdrllavn
ntnlqdvrheeavaslkntsdmvylkvakpgs

Timeline for d2fe5a1:

• d2fe5a1 first appeared in SCOP 1.73
  
• d2fe5a1 appears in SCOPe 2.05
  
• d2fe5a1 appears in SCOPe 2.07
  
• d2fe5a1 appears in the current release, SCOPe 2.08