Lineage for d2fe5a1 (2fe5 A:223-314)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666761Protein Synapse-associated protein 102 [101713] (1 species)
  7. 666762Species Human (Homo sapiens) [TaxId:9606] [101714] (2 PDB entries)
  8. 666763Domain d2fe5a1: 2fe5 A:223-314 [133323]
    2nd PDZ domain
    complexed with gol, so4

Details for d2fe5a1

PDB Entry: 2fe5 (more details), 1.1 Å

PDB Description: The Crystal Structure of the Second PDZ Domain of Human DLG3
PDB Compounds: (A:) Presynaptic protein SAP102

SCOP Domain Sequences for d2fe5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]}
timevnllkgpkglgfsiaggignqhipgdnsiyitkiieggaaqkdgrlqigdrllavn
ntnlqdvrheeavaslkntsdmvylkvakpgs

SCOP Domain Coordinates for d2fe5a1:

Click to download the PDB-style file with coordinates for d2fe5a1.
(The format of our PDB-style files is described here.)

Timeline for d2fe5a1: