Lineage for d2fdsa1 (2fds A:1-324)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079267Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 2079273Species Plasmodium berghei [TaxId:5821] [141752] (1 PDB entry)
    Uniprot Q4Z4C3 2-325
  8. 2079274Domain d2fdsa1: 2fds A:1-324 [133320]
    Other proteins in same PDB: d2fdsb_
    complexed with iod

Details for d2fdsa1

PDB Entry: 2fds (more details), 1.72 Å

PDB Description: crystal structure of plasmodium berghei orotidine 5'-monophosphate decarboxylase (ortholog of plasmodium falciparum pf10_0225)
PDB Compounds: (A:) orotidine-monophosphate-decarboxylase

SCOPe Domain Sequences for d2fdsa1:

Sequence, based on SEQRES records: (download)

>d2fdsa1 c.1.2.3 (A:1-324) Protozoan orotidine monophosphate decarboxylase {Plasmodium berghei [TaxId: 5821]}
hfktklknrrnevntclcigldpdeddiknfmrneekngyknvknnmnsnnnrienviki
gkeilltdeenienlseedkffyffnhfcfyiinntkeyaliykmnfafyipygsvgina
lknvfdylnsmniptmldmkindigntvknyrkfifeylksdsctinvymgtsmlkdicf
dyeknkyysayvlikttnkdsfifqnelsindkqayivmaeetqkmatdlkidqnnefig
fvvgsnafeemkiirnkfpdsyilspgigaqngdlyktlkngynkdyekllinvgraitk
spnpkkssesyynqiiqifkdien

Sequence, based on observed residues (ATOM records): (download)

>d2fdsa1 c.1.2.3 (A:1-324) Protozoan orotidine monophosphate decarboxylase {Plasmodium berghei [TaxId: 5821]}
hfktklknrrnevntclcigldpdeddiknfmrneekngyknvknnmnnnnrienvikig
keilltdeenienlseedkffyffnhfcfyiinntkeyaliykmnfafyipygsvginal
knvfdylnsmniptmldmkindigntvknyrkfifeylksdsctinvymgtsmlkdicfd
yeknkyysayvlikttnkdsfifqnelsindkqayivmaeetqkmatdlkidqnnefigf
vvgsnafeemkiirnkfpdsyilspgidlyktlkngynkdyekllinvgraitkspnpkk
ssesyynqiiqifkdien

SCOPe Domain Coordinates for d2fdsa1:

Click to download the PDB-style file with coordinates for d2fdsa1.
(The format of our PDB-style files is described here.)

Timeline for d2fdsa1: