Lineage for d2fdoa1 (2fdo A:1-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242968Fold d.337: AF2331-like [143994] (1 superfamily)
    interlocked dimer of beta-alpha-beta(2)-alpha-beta-(alpha) subunits; 3 layers: b/b/a
  4. 2242969Superfamily d.337.1: AF2331-like [143995] (1 family) (S)
  5. 2242970Family d.337.1.1: AF2331-like [143996] (1 protein)
  6. 2242971Protein Hypothetical protein AF2331 [143997] (1 species)
  7. 2242972Species Archaeoglobus fulgidus [TaxId:2234] [143998] (1 PDB entry)
    Uniprot O27953 1-92
  8. 2242973Domain d2fdoa1: 2fdo A:1-92 [133314]
    Other proteins in same PDB: d2fdoa2, d2fdob3

Details for d2fdoa1

PDB Entry: 2fdo (more details), 2.4 Å

PDB Description: crystal structure of the conserved protein of unknown function af2331 from archaeoglobus fulgidus dsm 4304 reveals a new type of alpha/beta fold
PDB Compounds: (A:) Hypothetical protein AF2331

SCOPe Domain Sequences for d2fdoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdoa1 d.337.1.1 (A:1-92) Hypothetical protein AF2331 {Archaeoglobus fulgidus [TaxId: 2234]}
mpayvfskesflkfleghleddvvvvvssdvtdfckklsesmvgekeycfaefafpadif
dadedeidemmkyaivfvekeklseagrnair

SCOPe Domain Coordinates for d2fdoa1:

Click to download the PDB-style file with coordinates for d2fdoa1.
(The format of our PDB-style files is described here.)

Timeline for d2fdoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fdoa2