SCOPe 2.07: Domain d2fdka_: 2fdk A:

Lineage for d2fdka_ (2fdk A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (3 proteins)
   automatically mapped to Pfam PF13532

6. Protein Alkylated DNA repair protein AlkB [141629] (1 species)

7. Species Escherichia coli [TaxId:562] [141630] (11 PDB entries)
   Uniprot P05050 15-214

8. Domain d2fdka_: 2fdk A: [133313]
   automated match to d2fd8a1
   protein/DNA complex; complexed with akg, fe2, sin

Details for d2fdka_

PDB Entry: 2fdk, 2.3 Å

PDB Description: crystal structure of alkb in complex with fe(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t (air 9 days)

PDB Compounds: (A:) Alkylated DNA repair protein alkB

SCOPe Domain Sequences for d2fdka_:

Sequence; same for both SEQRES and ATOM records:

>d2fdka_ b.82.2.10 (A:) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
aagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrqg
ylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdkd
epdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplkag
fhpltidcrynltfrqagk

Timeline for d2fdka_:

• d2fdka_ first appeared in SCOP 1.73, called d2fdka1
  
• d2fdka_ appears in SCOPe 2.06
  
• d2fdka_ appears in the current release, SCOPe 2.08