Lineage for d2fdka_ (2fdk A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807787Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1808017Family b.82.2.10: AlkB-like [141628] (3 proteins)
    automatically mapped to Pfam PF13532
  6. 1808021Protein Alkylated DNA repair protein AlkB [141629] (1 species)
  7. 1808022Species Escherichia coli [TaxId:562] [141630] (10 PDB entries)
    Uniprot P05050 15-214
  8. 1808028Domain d2fdka_: 2fdk A: [133313]
    automated match to d2fd8a1
    protein/DNA complex; complexed with akg, fe2, sin

Details for d2fdka_

PDB Entry: 2fdk (more details), 2.3 Å

PDB Description: crystal structure of alkb in complex with fe(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t (air 9 days)
PDB Compounds: (A:) Alkylated DNA repair protein alkB

SCOPe Domain Sequences for d2fdka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdka_ b.82.2.10 (A:) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
aagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrqg
ylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdkd
epdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplkag
fhpltidcrynltfrqagk

SCOPe Domain Coordinates for d2fdka_:

Click to download the PDB-style file with coordinates for d2fdka_.
(The format of our PDB-style files is described here.)

Timeline for d2fdka_: