| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
| Family b.82.2.10: AlkB-like [141628] (3 proteins) automatically mapped to Pfam PF13532 |
| Protein Alkylated DNA repair protein AlkB [141629] (1 species) |
| Species Escherichia coli [TaxId:562] [141630] (11 PDB entries) Uniprot P05050 15-214 |
| Domain d2fdka_: 2fdk A: [133313] automated match to d2fd8a1 protein/DNA complex; complexed with akg, fe2, sin |
PDB Entry: 2fdk (more details), 2.3 Å
SCOPe Domain Sequences for d2fdka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fdka_ b.82.2.10 (A:) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
aagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrqg
ylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdkd
epdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplkag
fhpltidcrynltfrqagk
Timeline for d2fdka_: