Lineage for d2fdja1 (2fdj A:15-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677672Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 677837Family b.82.2.10: AlkB-like [141628] (2 proteins)
  6. 677841Protein Alkylated DNA repair protein AlkB [141629] (1 species)
  7. 677842Species Escherichia coli [TaxId:562] [141630] (7 PDB entries)
  8. 677844Domain d2fdja1: 2fdj A:15-214 [133312]
    automatically matched to 2FD8 A:15-214
    complexed with fe2, sin

Details for d2fdja1

PDB Entry: 2fdj (more details), 2.1 Å

PDB Description: crystal structure of alkb in complex with fe(ii) and succinate
PDB Compounds: (A:) Alkylated DNA repair protein alkB

SCOP Domain Sequences for d2fdja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdja1 b.82.2.10 (A:15-214) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
laagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrq
gylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdk
depdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka
gfhpltidcrynltfrqagk

SCOP Domain Coordinates for d2fdja1:

Click to download the PDB-style file with coordinates for d2fdja1.
(The format of our PDB-style files is described here.)

Timeline for d2fdja1: