SCOPe 2.08: Domain d2fdja2: 2fdj A:13-216

Lineage for d2fdja2 (2fdj A:13-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (3 proteins)
   automatically mapped to Pfam PF13532

6. Protein Alkylated DNA repair protein AlkB [141629] (1 species)

7. Species Escherichia coli [TaxId:562] [141630] (11 PDB entries)
   Uniprot P05050 15-214

8. Domain d2fdja2: 2fdj A:13-216 [133312]
   Other proteins in same PDB: d2fdja3
   automated match to d2fd8a1
   complexed with fe2, sin

Details for d2fdja2

PDB Entry: 2fdj, 2.1 Å

PDB Description: crystal structure of alkb in complex with fe(ii) and succinate

PDB Compounds: (A:) Alkylated DNA repair protein alkB

SCOPe Domain Sequences for d2fdja2:

Sequence; same for both SEQRES and ATOM records:

>d2fdja2 b.82.2.10 (A:13-216) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
eplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtth
rqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhq
dkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqpl
kagfhpltidcrynltfrqagkke

Timeline for d2fdja2:

• d2fdja2 first appeared in SCOP 1.73, called d2fdja1
  
• d2fdja2 appears in SCOPe 2.07