SCOP 1.75: Domain d2fdia1: 2fdi A:15-214

Lineage for d2fdia1 (2fdi A:15-214)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (2 proteins)

6. Protein Alkylated DNA repair protein AlkB [141629] (1 species)

7. Species Escherichia coli [TaxId:562] [141630] (7 PDB entries)
   Uniprot P05050 15-214

8. Domain d2fdia1: 2fdi A:15-214 [133311]
   automatically matched to 2FD8 A:15-214
   complexed with akg, fe2, ma7, sin

Details for d2fdia1

PDB Entry: 2fdi, 1.8 Å

PDB Description: crystal structure of alkb in complex with fe(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t (air 3 hours)

PDB Compounds: (A:) Alkylated DNA repair protein alkB

SCOP Domain Sequences for d2fdia1:

Sequence; same for both SEQRES and ATOM records:

>d2fdia1 b.82.2.10 (A:15-214) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
laagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrq
gylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdk
depdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka
gfhpltidcrynltfrqagk

Timeline for d2fdia1:

• d2fdia1 first appeared in SCOP 1.73
  
• d2fdia1 is called d2fdia_ in SCOPe 2.01
  
• d2fdia1 appears in the current release, SCOPe 2.08, called d2fdia_