Lineage for d2fdga_ (2fdg A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2081124Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2081396Family b.82.2.10: AlkB-like [141628] (3 proteins)
    automatically mapped to Pfam PF13532
  6. 2081400Protein Alkylated DNA repair protein AlkB [141629] (1 species)
  7. 2081401Species Escherichia coli [TaxId:562] [141630] (10 PDB entries)
    Uniprot P05050 15-214
  8. 2081409Domain d2fdga_: 2fdg A: [133309]
    automated match to d2fd8a1
    protein/DNA complex; complexed with fe2, sin

Details for d2fdga_

PDB Entry: 2fdg (more details), 2.2 Å

PDB Description: crystal structure of alkb in complex with fe(ii), succinate, and methylated trinucleotide t-mea-t
PDB Compounds: (A:) Alkylated DNA repair protein alkB

SCOPe Domain Sequences for d2fdga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdga_ b.82.2.10 (A:) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
laagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrq
gylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdk
depdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka
gfhpltidcrynltfrqagk

SCOPe Domain Coordinates for d2fdga_:

Click to download the PDB-style file with coordinates for d2fdga_.
(The format of our PDB-style files is described here.)

Timeline for d2fdga_: