SCOP 1.75: Domain d2fdga1: 2fdg A:15-214

Lineage for d2fdga1 (2fdg A:15-214)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (2 proteins)

6. Protein Alkylated DNA repair protein AlkB [141629] (1 species)

7. Species Escherichia coli [TaxId:562] [141630] (7 PDB entries)
   Uniprot P05050 15-214

8. Domain d2fdga1: 2fdg A:15-214 [133309]
   automatically matched to 2FD8 A:15-214
   complexed with fe2, ma7, sin

Details for d2fdga1

PDB Entry: 2fdg, 2.2 Å

PDB Description: crystal structure of alkb in complex with fe(ii), succinate, and methylated trinucleotide t-mea-t

PDB Compounds: (A:) Alkylated DNA repair protein alkB

SCOP Domain Sequences for d2fdga1:

Sequence; same for both SEQRES and ATOM records:

>d2fdga1 b.82.2.10 (A:15-214) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
laagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrq
gylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdk
depdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka
gfhpltidcrynltfrqagk

Timeline for d2fdga1:

• d2fdga1 first appeared in SCOP 1.73
  
• d2fdga1 is called d2fdga_ in SCOPe 2.01
  
• d2fdga1 appears in the current release, SCOPe 2.08, called d2fdga_