![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.10: AlkB-like [141628] (2 proteins) |
![]() | Protein Alkylated DNA repair protein AlkB [141629] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141630] (7 PDB entries) Uniprot P05050 15-214 |
![]() | Domain d2fdfa1: 2fdf A:15-214 [133308] automatically matched to 2FD8 A:15-214 complexed with akg, co, ma7 |
PDB Entry: 2fdf (more details), 2.1 Å
SCOP Domain Sequences for d2fdfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fdfa1 b.82.2.10 (A:15-214) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]} laagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrq gylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdk depdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka gfhpltidcrynltfrqagk
Timeline for d2fdfa1: