Lineage for d2fdcb2 (2fdc B:415-593)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113231Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 protein domains)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2113317Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)
    contains large insertions in the first AAA domain
  7. 2113318Species Bacillus caldotenax [TaxId:1395] [52710] (4 PDB entries)
    Uniprot P56981
  8. 2113326Domain d2fdcb2: 2fdc B:415-593 [133305]
    automatically matched to d1d9xa2
    protein/DNA complex; complexed with flq

Details for d2fdcb2

PDB Entry: 2fdc (more details), 3.3 Å

PDB Description: structural basis of dna damage recognition and processing by uvrb: crystal structure of a uvrb/dna complex
PDB Compounds: (B:) UvrABC system protein B

SCOPe Domain Sequences for d2fdcb2:

Sequence, based on SEQRES records: (download)

>d2fdcb2 c.37.1.19 (B:415-593) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl
iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeir

Sequence, based on observed residues (ATOM records): (download)

>d2fdcb2 c.37.1.19 (B:415-593) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigraa
rnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeir

SCOPe Domain Coordinates for d2fdcb2:

Click to download the PDB-style file with coordinates for d2fdcb2.
(The format of our PDB-style files is described here.)

Timeline for d2fdcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fdcb1