| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Nucleotide excision repair enzyme UvrB, N-terminal domain [418968] (2 species) contains large insertions in the AAA domain |
| Species Bacillus caldotenax [TaxId:1395] [419430] (4 PDB entries) Uniprot P56981 |
| Domain d2fdcb1: 2fdc B:2-414 [133304] Other proteins in same PDB: d2fdca2, d2fdcb2 automatically matched to d1d9xa1 protein/DNA complex; complexed with flq has additional subdomain(s) that are not in the common domain |
PDB Entry: 2fdc (more details), 3.3 Å
SCOPe Domain Sequences for d2fdcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fdcb1 c.37.1.19 (B:2-414) Nucleotide excision repair enzyme UvrB, N-terminal domain {Bacillus caldotenax [TaxId: 1395]}
egrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkptl
viahnktlagqlyselkeffphnaveyfvsyydyyqpeayvpqtdtyiekdakindeidk
lrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiqy
drndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlgerehv
aifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmremg
fcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqvl
vdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirp
Timeline for d2fdcb1: