Lineage for d2fdca2 (2fdc A:415-594)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. Protein Nucleotide excision repair enzyme UvrB, C-terminal domain [418969] (2 species)
  7. Species Bacillus caldotenax [TaxId:1395] [419431] (4 PDB entries)
    Uniprot P56981
  8. 2870766Domain d2fdca2: 2fdc A:415-594 [133303]
    Other proteins in same PDB: d2fdca1, d2fdcb1
    automatically matched to d1d9xa2
    protein/DNA complex; complexed with flq

Details for d2fdca2

PDB Entry: 2fdc (more details), 3.3 Å

PDB Description: structural basis of dna damage recognition and processing by uvrb: crystal structure of a uvrb/dna complex
PDB Compounds: (A:) UvrABC system protein B

SCOPe Domain Sequences for d2fdca2:

Sequence, based on SEQRES records: (download)

>d2fdca2 c.37.1.19 (A:415-594) Nucleotide excision repair enzyme UvrB, C-terminal domain {Bacillus caldotenax [TaxId: 1395]}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl
iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird

Sequence, based on observed residues (ATOM records): (download)

>d2fdca2 c.37.1.19 (A:415-594) Nucleotide excision repair enzyme UvrB, C-terminal domain {Bacillus caldotenax [TaxId: 1395]}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lherieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigr
aarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird

SCOPe Domain Coordinates for d2fdca2:

Click to download the PDB-style file with coordinates for d2fdca2.
(The format of our PDB-style files is described here.)

Timeline for d2fdca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fdca1