Lineage for d2fdbr2 (2fdb R:3252-3360)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787122Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 787123Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (4 PDB entries)
  8. 787127Domain d2fdbr2: 2fdb R:3252-3360 [133301]
    Other proteins in same PDB: d2fdbm1, d2fdbn1
    automatically matched to d1cvsc2

Details for d2fdbr2

PDB Entry: 2fdb (more details), 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c
PDB Compounds: (R:) Fibroblast growth factor receptor 2

SCOP Domain Sequences for d2fdbr2:

Sequence, based on SEQRES records: (download)

>d2fdbr2 b.1.1.4 (R:3252-3360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
srhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkv
lkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl

Sequence, based on observed residues (ATOM records): (download)

>d2fdbr2 b.1.1.4 (R:3252-3360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
srhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvylkvlkaagvievlyir
nvtfedageytclagnsigisfhsawltvl

SCOP Domain Coordinates for d2fdbr2:

Click to download the PDB-style file with coordinates for d2fdbr2.
(The format of our PDB-style files is described here.)

Timeline for d2fdbr2: