SCOPe 2.08: Domain d2fdbr2: 2fdb R:3251-3360

Lineage for d2fdbr2 (2fdb R:3251-3360)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.4: I set domains [49159] (39 proteins)
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)
Domain d2fdbr2: 2fdb R:3251-3360 [133301]
Other proteins in same PDB: d2fdbm1, d2fdbn_
automated match to d1ev2g2

Details for d2fdbr2

PDB Entry: 2fdb (more details), 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c

PDB Compounds: (R:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d2fdbr2:

Sequence, based on SEQRES records: (download)

>d2fdbr2 b.1.1.4 (R:3251-3360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl

Sequence, based on observed residues (ATOM records): (download)

>d2fdbr2 b.1.1.4 (R:3251-3360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvylkvlkaagvievlyi
rnvtfedageytclagnsigisfhsawltvl

SCOPe Domain Coordinates for d2fdbr2:

Click to download the PDB-style file with coordinates for d2fdbr2.
(The format of our PDB-style files is described here.)

Timeline for d2fdbr2: