Lineage for d2fdbr1 (2fdb R:3153-3251)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656838Family b.1.1.4: I set domains [49159] (36 proteins)
  6. 656895Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 656896Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (4 PDB entries)
  8. 656899Domain d2fdbr1: 2fdb R:3153-3251 [133300]
    automatically matched to d1cvsc1

Details for d2fdbr1

PDB Entry: 2fdb (more details), 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c
PDB Compounds: (R:) Fibroblast growth factor receptor 2

SCOP Domain Sequences for d2fdbr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdbr1 b.1.1.4 (R:3153-3251) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
apywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvrnq
hwslimesvvpsdkgnytcvveneygsinhtyhldvver

SCOP Domain Coordinates for d2fdbr1:

Click to download the PDB-style file with coordinates for d2fdbr1.
(The format of our PDB-style files is described here.)

Timeline for d2fdbr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fdbr2