![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
![]() | Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries) |
![]() | Domain d2fdbr1: 2fdb R:3151-3250 [133300] Other proteins in same PDB: d2fdbm1, d2fdbn_ automated match to d1ev2g1 |
PDB Entry: 2fdb (more details), 2.28 Å
SCOPe Domain Sequences for d2fdbr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fdbr1 b.1.1.4 (R:3151-3250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve
Timeline for d2fdbr1:
![]() Domains from other chains: (mouse over for more information) d2fdbm1, d2fdbn_, d2fdbp1, d2fdbp2 |