Lineage for d2fdbp1 (2fdb P:2151-2250)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764414Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1764483Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 1764497Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (10 PDB entries)
  8. 1764509Domain d2fdbp1: 2fdb P:2151-2250 [133298]
    Other proteins in same PDB: d2fdbm1, d2fdbn_
    automated match to d1ev2g1

Details for d2fdbp1

PDB Entry: 2fdb (more details), 2.28 Å

PDB Description: Crystal Structure of Fibroblast growth factor (FGF)8b in complex with FGF Receptor (FGFR) 2c
PDB Compounds: (P:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d2fdbp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdbp1 b.1.1.4 (P:2151-2250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOPe Domain Coordinates for d2fdbp1:

Click to download the PDB-style file with coordinates for d2fdbp1.
(The format of our PDB-style files is described here.)

Timeline for d2fdbp1: