Lineage for d2fd6a2 (2fd6 A:50-132)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748907Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 748908Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 748909Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 748988Protein Urokinase-type plasminogen activator [57453] (1 species)
  7. 748989Species Human (Homo sapiens) [TaxId:9606] [57454] (5 PDB entries)
  8. 748994Domain d2fd6a2: 2fd6 A:50-132 [133294]
    Other proteins in same PDB: d2fd6a1
    automatically matched to d1urk_2
    complexed with edo, etx, fuc, nag, pg4, pge, so4

Details for d2fd6a2

PDB Entry: 2fd6 (more details), 1.9 Å

PDB Description: structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOP Domain Sequences for d2fd6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fd6a2 g.14.1.1 (A:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

SCOP Domain Coordinates for d2fd6a2:

Click to download the PDB-style file with coordinates for d2fd6a2.
(The format of our PDB-style files is described here.)

Timeline for d2fd6a2: