SCOPe 2.08: Domain d2fd6a2: 2fd6 A:50-132

Lineage for d2fd6a2 (2fd6 A:50-132)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein automated matches [226950] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225942] (12 PDB entries)

8. Domain d2fd6a2: 2fd6 A:50-132 [133294]
   Other proteins in same PDB: d2fd6a1, d2fd6h1, d2fd6h2, d2fd6l1, d2fd6l2, d2fd6u1, d2fd6u2, d2fd6u3
   automated match to d1urka2
   complexed with edo, etx, ndg, pg4, pge, so4

Details for d2fd6a2

PDB Entry: 2fd6, 1.9 Å

PDB Description: structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a

PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d2fd6a2:

Sequence; same for both SEQRES and ATOM records:

>d2fd6a2 g.14.1.1 (A:50-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

Timeline for d2fd6a2:

• d2fd6a2 first appeared in SCOP 1.73
  
• d2fd6a2 appears in SCOPe 2.07