Lineage for d2fd6a2 (2fd6 A:50-132)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033399Protein automated matches [226950] (2 species)
    not a true protein
  7. 3033400Species Human (Homo sapiens) [TaxId:9606] [225942] (12 PDB entries)
  8. 3033405Domain d2fd6a2: 2fd6 A:50-132 [133294]
    Other proteins in same PDB: d2fd6a1, d2fd6h1, d2fd6h2, d2fd6l1, d2fd6l2, d2fd6u1, d2fd6u2, d2fd6u3
    automated match to d1urka2
    complexed with edo, etx, ndg, pg4, pge, so4

Details for d2fd6a2

PDB Entry: 2fd6 (more details), 1.9 Å

PDB Description: structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d2fd6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fd6a2 g.14.1.1 (A:50-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

SCOPe Domain Coordinates for d2fd6a2:

Click to download the PDB-style file with coordinates for d2fd6a2.
(The format of our PDB-style files is described here.)

Timeline for d2fd6a2: