Lineage for d2fd6a1 (2fd6 A:11-49)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747957Protein Plasminogen activator (urokinase-type) [57221] (1 species)
  7. 747958Species Human (Homo sapiens) [TaxId:9606] [57222] (4 PDB entries)
  8. 747963Domain d2fd6a1: 2fd6 A:11-49 [133293]
    Other proteins in same PDB: d2fd6a2
    automatically matched to d1urk_1
    complexed with edo, etx, fuc, nag, pg4, pge, so4

Details for d2fd6a1

PDB Entry: 2fd6 (more details), 1.9 Å

PDB Description: structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOP Domain Sequences for d2fd6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fd6a1 g.3.11.1 (A:11-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
cdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt

SCOP Domain Coordinates for d2fd6a1:

Click to download the PDB-style file with coordinates for d2fd6a1.
(The format of our PDB-style files is described here.)

Timeline for d2fd6a1: