SCOP 1.73: Domain d2fd6a1: 2fd6 A:11-49

Lineage for d2fd6a1 (2fd6 A:11-49)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Plasminogen activator (urokinase-type) [57221] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57222] (4 PDB entries)

8. Domain d2fd6a1: 2fd6 A:11-49 [133293]
   Other proteins in same PDB: d2fd6a2
   automatically matched to d1urk_1
   complexed with edo, etx, fuc, nag, pg4, pge, so4

Details for d2fd6a1

PDB Entry: 2fd6, 1.9 Å

PDB Description: structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a

PDB Compounds: (A:) urokinase-type plasminogen activator

SCOP Domain Sequences for d2fd6a1:

Sequence; same for both SEQRES and ATOM records:

>d2fd6a1 g.3.11.1 (A:11-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
cdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt

Timeline for d2fd6a1:

• d2fd6a1 is new in SCOP 1.73
  
• d2fd6a1 appears in SCOP 1.75
  
• d2fd6a1 appears in the current release, SCOPe 2.08