Lineage for d2fd6a1 (2fd6 A:11-49)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2583282Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2583283Protein automated matches [226968] (4 species)
    not a true protein
  7. 2583284Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries)
  8. 2583291Domain d2fd6a1: 2fd6 A:11-49 [133293]
    Other proteins in same PDB: d2fd6a2, d2fd6h1, d2fd6h2, d2fd6l1, d2fd6l2, d2fd6u1, d2fd6u2, d2fd6u3
    automated match to d1urka1
    complexed with edo, etx, nag, ndg, pg4, pge, so4

Details for d2fd6a1

PDB Entry: 2fd6 (more details), 1.9 Å

PDB Description: Structure of Human Urokinase Plasminogen Activator in Complex with Urokinase Receptor and an anti-upar antibody at 1.9 A
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d2fd6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fd6a1 g.3.11.0 (A:11-49) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt

SCOPe Domain Coordinates for d2fd6a1:

Click to download the PDB-style file with coordinates for d2fd6a1.
(The format of our PDB-style files is described here.)

Timeline for d2fd6a1: