Lineage for d2fd5a2 (2fd5 A:77-180)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins) 
Protein Probable transcriptional regulator PA3133 [140893] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [140894] (1 PDB entry) 
Domain d2fd5a2: 2fd5 A:77-180 [133292]
Other proteins in same PDB: d2fd5a1
Details for d2fd5a2
PDB Entry: 2fd5 (more details), 1.7 Å
PDB Description: The crystal structure of a transcriptional regulator from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) Transcriptional regulatorSCOP Domain Sequences for d2fd5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fd5a2 a.121.1.1 (A:77-180) Probable transcriptional regulator PA3133 {Pseudomonas aeruginosa [TaxId: 287]}
lsgkerralaaafylsrkhrdaqvdagcplpatlaevarlpegfrevlsrhveimvtsla
espeetdvaladlvlmigglalaralgpgelsdrvlraakqavn
SCOP Domain Coordinates for d2fd5a2:
Click to download the PDB-style file with coordinates for d2fd5a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fd5a2:
- d2fd5a2 is new in SCOP 1.73
- d2fd5a2 appears in SCOP 1.75
- d2fd5a2 appears in the current release, SCOPe 2.08
View in 3D
