![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Probable transcriptional regulator PA3133 [140187] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [140188] (1 PDB entry) Uniprot Q9HZ91 1-76 |
![]() | Domain d2fd5a1: 2fd5 A:1-76 [133291] Other proteins in same PDB: d2fd5a2 |
PDB Entry: 2fd5 (more details), 1.7 Å
SCOPe Domain Sequences for d2fd5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fd5a1 a.4.1.9 (A:1-76) Probable transcriptional regulator PA3133 {Pseudomonas aeruginosa [TaxId: 287]} msdkktqtrarilgaatqallergavepsvgevmgaagltvggfyahfqskdalmleafe qllgkrrellgeldpg
Timeline for d2fd5a1: