Lineage for d2fd5a1 (2fd5 A:1-76)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Probable transcriptional regulator PA3133 [140187] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [140188] (1 PDB entry)
Uniprot Q9HZ91 1-76
Domain d2fd5a1: 2fd5 A:1-76 [133291]
Other proteins in same PDB: d2fd5a2
Details for d2fd5a1
PDB Entry: 2fd5 (more details), 1.7 Å
PDB Description: The crystal structure of a transcriptional regulator from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) Transcriptional regulatorSCOPe Domain Sequences for d2fd5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fd5a1 a.4.1.9 (A:1-76) Probable transcriptional regulator PA3133 {Pseudomonas aeruginosa [TaxId: 287]}
msdkktqtrarilgaatqallergavepsvgevmgaagltvggfyahfqskdalmleafe
qllgkrrellgeldpg
SCOPe Domain Coordinates for d2fd5a1:
Click to download the PDB-style file with coordinates for d2fd5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fd5a1:
- d2fd5a1 first appeared in SCOP 1.73
- d2fd5a1 appears in SCOPe 2.07
View in 3D
