SCOPe 2.07: Domain d2fd5a1: 2fd5 A:1-76

Lineage for d2fd5a1 (2fd5 A:1-76)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Probable transcriptional regulator PA3133 [140187] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140188] (1 PDB entry)
   Uniprot Q9HZ91 1-76

8. Domain d2fd5a1: 2fd5 A:1-76 [133291]
   Other proteins in same PDB: d2fd5a2

Details for d2fd5a1

PDB Entry: 2fd5, 1.7 Å

PDB Description: The crystal structure of a transcriptional regulator from Pseudomonas aeruginosa PAO1

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2fd5a1:

Sequence; same for both SEQRES and ATOM records:

>d2fd5a1 a.4.1.9 (A:1-76) Probable transcriptional regulator PA3133 {Pseudomonas aeruginosa [TaxId: 287]}
msdkktqtrarilgaatqallergavepsvgevmgaagltvggfyahfqskdalmleafe
qllgkrrellgeldpg

Timeline for d2fd5a1:

• d2fd5a1 first appeared in SCOP 1.73
  
• d2fd5a1 appears in SCOPe 2.06