Lineage for d2fcwb1 (2fcw B:86-124)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637892Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 2637893Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 2637894Family g.12.1.1: LDL receptor-like module [57425] (7 proteins)
  6. 2637904Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 2637905Species Human (Homo sapiens) [TaxId:9606] [57427] (13 PDB entries)
    Uniprot P01130 272-353
  8. 2637906Domain d2fcwb1: 2fcw B:86-124 [133289]
    Other proteins in same PDB: d2fcwa1
    automated match to d1n7da6
    complexed with ca, mpd, na

Details for d2fcwb1

PDB Entry: 2fcw (more details), 1.26 Å

PDB Description: structure of a complex between the pair of the ldl receptor ligand- binding modules 3-4 and the receptor associated protein (rap).
PDB Compounds: (B:) low-density lipoprotein receptor

SCOPe Domain Sequences for d2fcwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
ktcsqaefrchdgkcisrqfvcdsdrdcldgsdeascpv

SCOPe Domain Coordinates for d2fcwb1:

Click to download the PDB-style file with coordinates for d2fcwb1.
(The format of our PDB-style files is described here.)

Timeline for d2fcwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fcwb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2fcwa1